PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn357091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 309aa    MW: 33423.3 Da    PI: 8.5548
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn357091genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.4e-3945102360
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                 +++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk+
  Achn357091  45 QENLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKT 102
                 7889****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.2E-3346102IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-254899IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.50648102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MIQELLGETT SLIGGERKIS LSNILEASSP SPSPSPSPSP SSSAQENLRC PRCDSSNTKF  60
CYYNNYNLTQ PRHFCKTCRR YWTKGGALRN VPIGGGCRKN KTGGTTLTPP PPSSLGGKPN  120
SSGMFNKAFH CSEVEKSGLT QSPILWAPPQ NSHILALLRA NQNPNPNPNL DMVTPNPVSV  180
KEECFLSSGT RELGLGLDPF YQMNPMWRGN LQQVQQQNGF LLGEVQNTGV QDLYHRLRSS  240
SAAGYYNNPQ DHSSLPVLLS NNIVASSSTS TNLESAPVAA SGELGYWNPT LSWSDHHLPS  300
TANGTAYR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM0843635e-57AM084363.1 Hordeum vulgare subsp. vulgare partial dof15 gene for dof zinc finger protein 15.
GenBankKP6629115e-57KP662911.1 Cajanus cajan Dof7 (Dof7) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310753.15e-81hypothetical protein POPTR_0007s11620g
TrEMBLA9P9B56e-81A9P9B5_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11620.12e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.17e-33DOF zinc finger protein 1